Dataset for protein E1B 19K of organism Titi monkey adenovirus ECC 2011

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G0ZAH2_E1B19K-01 E1B19K protein OS=[Viruses] Titi monkey adenovirus ECC-2011 GN=E1B19K (length=218 residues).
MDLLKFLEDFENCRQVLQQASKRTGGWSRWLLGNQLVRTVAQVKTDYSEHFEQLLQEQNRLLLNNLELGHTRALNGVLRE
LDFENTGRVVAGLAFLAYLLDRWDENSVLSPGYRLDCLALAIWKHTLREGILRGVMQGPRARVNREIRREVEERLTQVQR
ELEERERERQQREREQQQQEGEMTTSIWRPSMEAEWPPRAGMDPPLEEQWEADHDPEA
© 1998-2018