Dataset for protein adenoviridae of organism Simian mastadenovirus C

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|M9YVF6_E1B19K-01 E1B19K protein OS=[Viruses] Simian mastadenovirus C GN=E1B19K (length=164 residues).
MDLLRLLSDYEVLRKLLETACEKNRSCWRFFFGSTLSNVVHRVKREHSEEFSRLVADVPGLFVSLDLGHHSYFQEKIVKG
LVFESTGRTVVSVAFICFLLDKWSSDSHLSWDYMLDYMTMALWRALLRRRRACIYLPVQPQQGLERVEEEEEENPRAGVD
PPLE
>gnl|bcl2dbpro|M9YXY5_E1B19K-01 E1B19K protein OS=[Viruses] Simian mastadenovirus C GN=E1B19K (length=166 residues).
MDLLRLLSDYEVLRKLLETACEKTSSCWRFFFGSTLSNVVHRVKREHSEEFSRLVADVPGLFVSLDLGHHSYFQEKIVKG
LVFESTGRTVVSVAFICFLLDKWSSDSHLSWDYMLDYMTMALWRALLRRRRACIYLPVQPQRGLERVEEEEEENENPRAG
VDPPLE
© 1998-2018