Dataset for protein adenoviridae of organism Simian adenovirus serotype 7

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|P06501_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus serotype 7 GN=E1B19K (length=180 residues).
MDLRTALQTFESTRRLLELCSNRTSFLWRWLFGTPLSRLVRQVKLEYEKDFERILDQCPGVFESLELGYHKVFEEKIVKE
LDFSSPGRAVAAVAFASYLLDRWNTRTHLSPGYQMDYISLNLWKFWLRRRVYNYSRGLPQLGPAAPLARQGSQQEEQQQR
QEEEQVQEEMRSGLDPPTEN
© 1998-2018