Dataset for protein E1B 19K of organism Simian adenovirus ch1

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A076V686_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus ch1 GN=E1B19K (length=161 residues).
MELEAVLQSYQSIRQLLQHTSRNTSGFWRYLFGSTLSKVVHRVKEDYRNEFENILAGCPGLLASLDLCHHSIFQEKVVRS
LDFSSAGRTVASIAFLVTVLDKWSQASQLSWDYMLDYMTMQLWRAWLTRRVCIYSLARPLTMPRLPTLQEEPEERDPAVE
K
© 1998-2018