Dataset for protein adenoviridae of organism Simian adenovirus DM 2014

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A097IW62_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus DM-2014 GN=E1B19K (length=179 residues).
MDLDRVLENYNSLRKVVEEASEQTSGWWRKLFGCRLSCLVVQAKFEYREEFERLFAEVPGLLESLNFCHHAVFYEKIICS
LDFCTPGRTIAALAFCTYILDRWNKETHLSAGYTLDYITLQLWKAYMRKGKIYTFSREPRSLQRLQTSLRRRLGMPTDDR
VCLLEAENPRAGMDPPSEN
© 1998-2018