Dataset for protein E1B 19K of organism Simian adenovirus B

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|M9YVA3_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus B GN=E1B19K (length=181 residues).
MDLRVELQTFESTRCLLELCSNRDPWWKRLLFGTSLCRLVRQVKEEYQSEFEHILSTCQGLFESLELGHHTVFQEKIVKA
LDFSSPGRAVAAIAFAAFILDRWNTQTQLSPGYTLDYISLQLWRFWLRRRVYNYSRGLPPLGRASSPEEQSPEVKPEVAG
QGEEQEQEPALRSGLDPPEEN
© 1998-2018