Dataset for protein E1B 19K of organism Simian adenovirus A1285

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|H9AAK5_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus A1285 GN=E1B19K (length=217 residues).
MINGCELWLFIQRGLPGRYKGSGFQARGIYPLAAFMDLRAELQTFESTRRLVELCSNRSSWFGRFLFGSTLCRVVRQVKE
EYQSEFEHILSNCPGLFVSLDLGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFLLDRWNAQTQLSPGYTLDYISLQLWRF
WLRRRVYNYSRGLPPLGLASVAEERSEESKPEVNPEAQGEAKEETLRSGLDPPVEEN
© 1998-2018