Dataset for protein adenoviridae of organism Simian adenovirus A1173

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|H9AAD9_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus A1173 GN=E1B19K (length=182 residues).
MDLRAELQTFESTRRLVELCSNRSSWFGRFLFGSTLCRVVRQVKEEYQSEFEHILSNCPGLFVSLDLGHHTVFQEKIVKA
LDFSSPGRAVAAIAFAAFLLDRWNAQTQLSPGYTLDYISLQLWRFWLRRRVYNYSRGLPPLGLASVAEERSEESKPEVNP
EAQGEAKEETLRSGLDPPVEEN
© 1998-2018