Dataset for protein adenoviridae of organism Simian adenovirus 8

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0M4NHE0_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 8 GN=E1B19K (length=217 residues).
MINCCELWLFIQRVLPGRYKGSGFQARGIYPLAAFMDLRAELQTFESTRRLVELCSNRSSWFGRFLFGSTLCRVVRQVKE
EYQSEFEHILSNCPGLFVSLDLGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFLLDRWNAQTQLSPGYTLDYISLQLWRF
WLRRRVYNYSRGLPPLGLASVAEERSEESKPEVNPEAQGEAKEEALRSGLDPPVEED
© 1998-2018