Dataset for protein E1B 19K of organism Simian adenovirus 6

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|H9TER0_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 6 GN=E1B19K (length=185 residues).
MDLYESLENLSSLRRLLEEASDRTSYIWRFLFGSPLSRFLHRVKREHLTEFDGLLEQLPGLFDSLNLGHRTLLEERLFPQ
LDFSSPGRLCSALAFAVHLLDRWNEQTQLSPGYTLDFLTLCLWKFGIRRGRKLYGRLVERHPSLRQQRLQAQVLLRREDL
EAISEEESGMEEKNPRAGLDPPAEE
© 1998-2018