Dataset for protein adenoviridae of organism Simian adenovirus 48

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F2WTG5_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 48 GN=E1B19K (length=184 residues).
MDLYESLENLSSLRRLLEEASDRTSYIWRFLFGSPLSRFLYRVKREHLTEFDGLLEQLPGLFDSLNLGHRTLLEERLFPQ
LDFSSPGRLCSALAFAVHLLDRWNEQTQLSPGYTLDFLTLCLWKFGIRRGRKLYGRLVERHPSLRQQRLQAQVLLRREDL
EAISEEESGMEENPRAGLDPPAEE
© 1998-2018