Dataset for protein adenoviridae of organism Simian adenovirus 3

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q695T5_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 3 GN=E1B19K (length=185 residues).
MDLYESLENLSSLRRLLEEASDRTSYIWRFLFGSPLSRFLYRVKREHLTEFDGLLEQLPGLFDSLNLGHRTLLEERLFPQ
LDFSSPGRLCSALAFAVHLLDRWNEQTQLSPGYTLDFLTLCLWKFGIRRGRKLYGRLVERHPSLRQQRLQAQVLLRREDL
EAISEEESGMEEKNPRAGLDPPAEE
© 1998-2018