Dataset for protein E1B 19K of organism Simian adenovirus 23

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q6QPF3_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 23 GN=E1B19K (length=190 residues).
MEIWTVLEDFHQTRQLLENSSEGVSYLWRFCFGGPLAKLVYRAKQDYKEQFEDILRECPGIFDSLNLGHQSHFNQSILRA
LDFSTPGRTTAAVAFFAFILDKWSQETHFSRDYRLDCLAVALWRTWRCQRLNAISGYLPVQPVDTLRILSLQSPQEHQRR
QQPQQEQQQEEDREENPRAGLDPPVAEEEE
© 1998-2018