Dataset for protein adenoviridae of organism Simian adenovirus 19

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0M3TH31_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 19 GN=E1B19K (length=166 residues).
MDLLRLLSDYEVLRKLLETACEKTSSCWRFFFGSTLSNVVHRVKREHSEEFSRLVADVPGLFVSLDLGHHSYFQEKIVKG
LVFESTGRTVVSVAFICFLLDKWSSDSHLSWDYMLDYMTMALWRALLRRRRACIYLPVQPQRGLERVEEEEEENENPRAG
VDPPLE
© 1998-2018