Dataset for protein adenoviridae of organism Simian adenovirus 18

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|H8PFZ1_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 18 GN=E1B19K (length=168 residues).
MEYWSELQNYQSLRRLLELASARTSTCWRFCFGSTLSNVVYRVKQEYSSRFSELLARYPAVFVSLDLGHHVYFQEAVVRY
LDFSTPGRAVSAIAFICFVLDRWSAQTRLSPGYTLDYLTMSLWRAMLRKRRVSGFSPARPPHGLDPVLEESELEEEENPR
AGLDPPAE
© 1998-2018