Dataset for protein E1B 19K of organism Simian adenovirus 16

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0M4N3Z1_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 16 GN=E1B19K (length=183 residues).
MDLRTALQTFESTRRLLELCSNRTSFLWRWLFGTPLSRLVRQVKLEYEKDFERILDQCPGVFESLELGYHKVFEDKIVKE
LDFSSPGRAVAAVAFASYLLDRWNTRTHLSPGYQMDYISLNLWKFWLRRRVYNYSRGLPQLGPVAPLVRQGSQQEEQQQQ
RQEEQQVQEEGEMRSGLDPPTEN
© 1998-2018