Dataset for protein adenoviridae of organism Simian adenovirus 13

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A0M3TH18_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 13 GN=E1B19K (length=187 residues).
MKRPVAAEVQMELDRLLENYNSLRRVLEEASEDTSVWWRKLFGCRVSQLVVQAKVEYKEEFEKLFSEVPGLVDSLNFCHH
AFFYEKVICGLDFCTPGRTIAALAFCAFILDKWNKETHLSKGYTLDYISLQLWKAYMRKGKIYTFSQGPRSLPQRVRRRL
GFKTEDQTRLLEAEEEPRAGTDPPSET
>gnl|bcl2dbpro|A0A1W5PVU4_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 13 GN=E1B19K (length=188 residues).
MMKRPVAAEVQMELDRLLENYNSLRRVLEEASEDTSVWWRRLFGCRVSQLVVQAKVEYKEEFEKLFSEVPGLVDSLNFCH
HAFFYEKVICGLDFCTPGRTIAALAFCAFILDKWNKETHLSRGYTLDYISLQLWKAYMRKGKIYTFSQGPRSLPQRVRRR
LGFQTEDQTRLLEAEEEPRAGMDPPSET
© 1998-2018