Dataset for protein Unclassified of organism Rousettus aegyptiacus adenovirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A344X9T9_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Rousettus aegyptiacus adenovirus (length=123 residues).
MTREVYSVKLEKASDFEELLESEPTILYYLRLGESIHFEEVVTPALLFGTTGRTITSLAFLAFLIDTLKQQSIFTWEYIV
EVIALGTWKQLTRTTMRESLRNQPTALPETLEEINLGSKEEEK
© 1998-2019