Dataset for protein E1B 19K of organism Rhesus adenovirus 54

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2H5AI04_E1B19K-01 E1B19K protein OS=[Viruses] Rhesus adenovirus 54 GN=E1B19K (length=168 residues).
MDLLGDLREFGVVRRLLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPGVFVALDLGHHSLFQEKIIKN
LTFTSPGRTVASAAFITYILDQWSNSGSHLSWEYMLDYMSMALWRAMLRRRVCIYLRAQPPRLDRVEEEDEPGETENLRA
GLDPPTED
© 1998-2018