Dataset for protein adenoviridae of organism Rhesus adenovirus 52

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0A1EUC8_E1B19K-01 E1B19K protein OS=[Viruses] Rhesus adenovirus 52 GN=E1B19K (length=168 residues).
MDLLGDLREFGVVRRLLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPGVFVALDLGHHSLFQEKIIKN
LTFTSPGRTVASAAFITYILDQWSNSGSHLSWEYMLDYMSMALWRAMLRRRVCIYLRAQPPRLDRVEEEDEPGETENLRA
GLDPPTED
© 1998-2018