Dataset for protein Unclassified of organism Porcine adenovirus A serotype 3

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q9WA49_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Porcine adenovirus A serotype 3 (length=202 residues).
MDYQLLAKLTNVNYLRKVIVQGSQNCPWWKKIFSDRFIKVVAEARRQYGQELIEIFVEGERGFGPEFLREGGLYEEAVLK
ELDFSTLGRTVASVALVCFIFEKLQKHSGWTDEGILSLLVPPLCSLLEARMMAEQVRQGLCIIRMPSAEREMLLPSGSSG
SGSGAGMRDQVVPKRPREQEEEEEDEDGMEASGRRLEGPDLV
© 1998-2018