Dataset for protein Unclassified of organism Porcine adenovirus 5

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q994F2_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Porcine adenovirus 5 (length=163 residues).
MELELSLKLCKTLCDFKNLTRVVYYASDRPGWLSRYFFGGRLAQLVYKAKVDYHQTLTELFEDDQSFWCLLESGRTLGFE
AKVVPWLDFSSTGRVVSSLSLLAYLVDHLDCHTDFSKDYNLEVICAPVCCRLKTLVEIQKLRFRQEETMREALQEDQEAK
ILS
© 1998-2018