Dataset for protein Unclassified of organism Polar bear mastadenovirus 1

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2Z4QJM3_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Polar bear mastadenovirus 1 (length=166 residues).
MDFLRVFLQYSRVRELVRGVSARTGVWWRRIFYSRLINFIHQVKVDYWQEFARLAPEDAPFMRGLKEGNVFLLKGFISGH
LSFENPGRFVVAVAFLGYVFDQWDRSNTVFSADFLLEFVSVELWLAVRRYYTQMMDVRAAQLMTELANQEEEETWEDAPV
EIDGRE
© 1998-2019