Dataset for protein Unclassified of organism Murine adenovirus A serotype 1

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|P12535_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Murine adenovirus A serotype 1 (length=175 residues).
MLPVYPFLAPVFDTFESTRALFLEATLSLQEPWWFRLLSFFRSPRYTGLADVVRAIACEREADFTAITPSSLIEDIAEGR
FVMLVGLMEYLRFDTAGQGIVSFAFLSYLIDRVTKQSPLAHFTVVEVVSLVVWRTVKLSRRRERRWVSQLSTLAEEDEDE
EGTTLTTEAEQESSA
© 1998-2018