Dataset for protein Unclassified of organism Murine adenovirus 2

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|E7CH29_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Murine adenovirus 2 (length=333 residues).
MDLLKHLSEYKVLRDLVLESSSFKPWWWRRRGLSNLVRETIEKFRTEYEEVLGQVFFTRLNHQDFFLYHYVIREELDLST
PGHQISGISFVVYVLERWALLEQRFGRDYLVDSLVFPLYQRVRSELRWQSRQVLKPVRRFRRSQALPAEQRQSMPFPFQG
DRPTEPLLPSFRLSRSSPPSPNRPQSPLPALVVNQSSRVPPPSNATAAAPGCPPPPTVMIPTSKSLRPRSCPSGAIFTSS
SIDPNPSQRTSPPRPPPKLYQHQYQNLMLSETTSEMASLTVSSPTPPLPPMPPTETPVEKARRGSSDSLSSEREGSYRKV
PGTPARCRRALQL
© 1998-2018