Dataset for protein adenoviridae of organism Human mastadenovirus E

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A2L1F392_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus E GN=E1B19K (length=139 residues).
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAICRYSR
>gnl|bcl2dbpro|A0A2L1F3A2_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus E GN=E1B19K (length=183 residues).
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAISGYLPVQPLDTLRILSLQQISQERQR
RQQQQEDQEENPRAGLDPPAEEE
>gnl|bcl2dbpro|A0A2R3WN16_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus E GN=E1B19K (length=184 residues).
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAISGYLPVQPLDTLRILSLQQISQERQR
RQQQQEDQEENPRAGLDPPAEEEE
>gnl|bcl2dbpro|A0A2R3WN62_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus E GN=E1B19K (length=142 residues).
MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFIFDKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAIPATCRYSR
>gnl|bcl2dbpro|Q6H1D7_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus E GN=E1B19K (length=171 residues).
MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFIFDKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAISGYLPVQPLDTLRILSLQQQEDQEEN
PRAGLDPPAEE
© 1998-2018