Dataset for protein E1B 19K of organism Human mastadenovirus D

[Download (right click)] [Alignment] [Repertoires]

26 sequence(s)

>gnl|bcl2dbpro|A0A075TSZ1_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRSWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|A0A097I4T0_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPPEEELD
>gnl|bcl2dbpro|A0A0G2UY10_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=208 residues).
MTHGRGLVLYKWQHLGTWAQTFREFLMDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENL
FADCSGLLDSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRSWIRQRGQRI
LNYWLLQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|A0A1J0MS84_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRSWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|A0A291B0H2_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILGDFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFSDCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|B6DU90_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|E1CIR1_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|F8UFP5_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MEVWTILADFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFSDCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLHLHRQTSMLEEE
MREAMDDNPRSGLDPPSEEELD
>gnl|bcl2dbpro|G3CK71_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MEVWTILGDFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMYENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UG22_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLLQPAASGLLHLHRQTSMLEEE
MREAMDKNPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UGT5_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MEVWTILADFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLLQPAVPGLLRLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UGU0_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MEVWTILADFNKTRRLVEDSSDGCSGFWRHWFGTPLARLVYTVKKDYQEEFENLFADCSGLLDSLNLGHQALFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQQTHLTRDYILDFTAMHLWKAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UGX3_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSQTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UGY3_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLLQPAASGLLHLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UHG3_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLCLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UHH6_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRSWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UHQ8_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UHZ2_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELN
>gnl|bcl2dbpro|T1UK99_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MEVWTILGDFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYQEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQQTHLTRDYILDFTAMHLWKAWVRQRGQRILNYWLLQPAAPGLLHLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UKP8_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRSWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UKQ0_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFNKTRRLVEDSSDGCSGFWRHWFGSPLSRLVYTVKKDYQEEFENLFADCSGLLDSLNLGHQALFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQQTHLTRDYILDFTAMHLWKAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UKV6_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILGDFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFSDCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAVPGLLRLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1ULJ8_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNLGHQALFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1ULP4_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|X4Y9D2_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=208 residues).
MTHGRGLVLYKWQHLGTRAQTFREFLMDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENL
FADCSGLLDSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWRQDTQLSRGYILDFAAMHLWRSWIRQRGQRI
LNYWLLQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|X4YVU5_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MEVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFVDCSGLLDSLNLGHQALFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQQTHLTRDYILDFTAMHLWKAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
© 1998-2018