Dataset for protein adenoviridae of organism Human mastadenovirus B

[Download (right click)] [Alignment] [Repertoires]

16 sequence(s)

>gnl|bcl2dbpro|A0A0K0PX35_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=181 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPAMPSVLE
EEQQEDNPRAGLDPPVEEAEE
>gnl|bcl2dbpro|A0A0K0PX99_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=181 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSRGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPAMPAVLE
EEQQEDNPRAGLDPPVEEAEE
>gnl|bcl2dbpro|A0A1L7NRH1_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLEDASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLLDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFIATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|I6LEP5_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHRAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|I6LES1_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|J7I6Q4_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|J7I6S4_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILNYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|J7I6W7_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFVATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|J7ID56_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=178 residues).
MEVWAILEDLKQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|Q5UW22_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASELARVVFRIKQDYKQEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFIATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|T1UE63_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLESASDGVSGFWRFWFASELARVVFRIKQDYKQEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFIATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|T1UF50_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=178 residues).
MKVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|T1UFS4_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLEDASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFVATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|T1UIP3_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPAMPAVLE
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|T1UJX4_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFIATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|T2CI10_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=181 residues).
MEVWAILEDLRQTRQLLENASDGVSGLWRFWFGGDLARLVFRIKQDYRQEFEKLLDDCPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFIFDKWIPQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLE
EEHQEDNPRVGLDPPVEEAEE
© 1998-2018