Dataset for protein adenoviridae of organism Human mastadenovirus A

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|T1UEX7_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus A GN=E1B19K (length=156 residues).
MELEAVLQSFQSVRQLLQYTSKNTSGFWRYLFGSTLSKVVHRVKEDYREEFENILADCPGLLASLDLCHHSVFQERVVRS
LDFSSSGRTVASIAFLATVLDKWSERSHLSWDYMLDYMAMHLWRAWLKRRVCIYSLARPLTMPPLQEEQQNTTTEE
© 1998-2018