Dataset for protein E1B 19K of organism Human adenovirus F serotype 40

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A142G3J2_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 40 GN=E1B19K (length=167 residues).
MELWSELQSYQNLRRLLELASARTSSCWRILFGSTLANVIYRAKEEYSSRFADLLSHNPGIFASLNLGHHSFFQEIVIRN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSQGYTLDYMAMALWRTLLRRKRVLGCLPAQRPHGLDPVQEEEEEEENLRAG
LDPSTEL
>gnl|bcl2dbpro|P10543_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 40 GN=E1B19K (length=167 residues).
MELWSELQSYQNLRRLLELASARTSSCWRILFGSTLTNVIYRAKEEYSSRFADLLSHNPGIFASLNLGHHSFFQEIVIRN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSQGYTLDYMAMALWRTLLRRKRVLGCLPAQRPHGLDPVQEEEEEEENLRAG
LDPSTEL
© 1998-2018