Dataset for protein adenoviridae of organism Human adenovirus E serotype 4

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|P10406_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=142 residues).
MEIWTVLEDFHKTRQLLENASNGVSHLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPSLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFIFDKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAIPATCRYSR
>gnl|bcl2dbpro|Q2KSG6_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=183 residues).
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAISGYLPVQPLDTLRILSLQQISQERQR
RQQQQEDQEENPRAGLDPPAEEE
>gnl|bcl2dbpro|Q2KSG6_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=139 residues).
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAICRYSR
>gnl|bcl2dbpro|Q2KSM8_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=184 residues).
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAISGYLPVQPLDTLRILSLQQISQERQR
RQQQQEDQEENPRAGLDPPAEEEE
>gnl|bcl2dbpro|Q2KSM8_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=142 residues).
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAIPATCRYSR
>gnl|bcl2dbpro|Q5GFC7_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=142 residues).
MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFIFDKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAIPATCRYSR
>gnl|bcl2dbpro|Q5GFC8_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=171 residues).
MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFIFDKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAISGYLPVQPLDTLRILSLQQQEDQEEN
PRAGLDPPAEE
© 1998-2018