Dataset for protein E1B 19K of organism Human adenovirus D37

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|B2VQE3_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus D37 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|B9A681_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus D37 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELN
© 1998-2018