Dataset for protein adenoviridae of organism Human adenovirus D serotype 8

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A1P7YWR9_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus D serotype 8 GN=E1B19K (length=182 residues).
MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENIFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLLQPAASGLLHLHRQTSMLEEE
MREAMDKNPRSGLDPPSEEELD
>gnl|bcl2dbpro|A0A1P7YWY2_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus D serotype 8 GN=E1B19K (length=182 residues).
MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENIFADCSCLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLLQPAASGLLHLHRQTSMLEEE
MRESMDKNPRSGLDPPSEEELD
>gnl|bcl2dbpro|A0A1P7YXN8_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus D serotype 8 GN=E1B19K (length=182 residues).
MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENIFADCSCLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLLQPAASGLLHLHRQTSMLEEE
MREAMDKNPRSGLDPPSEEELD
>gnl|bcl2dbpro|A0A1P7YYY5_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus D serotype 8 GN=E1B19K (length=182 residues).
MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLLQPAASGLLHLHRQTSMLEEE
IREAMDKNPRSGLDPPLEEELD
>gnl|bcl2dbpro|A0A1P8C849_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus D serotype 8 GN=E1B19K (length=182 residues).
MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLLQPAALGLLHLHRQTSMLEEE
MREAMDKNPRSGLDPPSEEELD
>gnl|bcl2dbpro|B9A5A7_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus D serotype 8 GN=E1B19K (length=182 residues).
MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLLQPAASGLLHLHRQTSMLEEE
MREAMDKNPRSGLDPPSEEELD
© 1998-2018