Dataset for protein E1B 19K of organism Human adenovirus C serotype 5

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|P03246_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus C serotype 5 GN=E1B19K (length=176 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQEEARRRR
QEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|Q6VGV8_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus C serotype 5 GN=E1B19K (length=176 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQEEARRRR
QEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|Q6WQ37_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus C serotype 5 GN=E1B19K (length=176 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALLQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQEEARRRR
QEQSPWNPRAGLDPRE
© 1998-2018