Dataset for protein E1B 19K of organism Human adenovirus C serotype 1

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|Q71BY5_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus C serotype 1 GN=E1B19K (length=55 residues).
MRHIICHGGVITEEMAASLLDQLIEEVLCLNLSLSPSQNRNLQDLPGVLKWCLLS
>gnl|bcl2dbpro|Q71BY5_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus C serotype 1 GN=E1B19K (length=180 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQEEAR
RRRRQEQSPWNPRAGLDPRE
© 1998-2018