Dataset for protein Unclassified of organism Human adenovirus B serotype 7

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A219PC56_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Human adenovirus B serotype 7 (length=79 residues).
MDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILNYWPVQPLGVAGILRHPPTMPAVLQEEQQEDNPRAGLDPPVEE
© 1998-2018