Dataset for protein E1B 19K of organism Human adenovirus B serotype 7

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A220VZ73_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus B serotype 7 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFCFGGDLARLVFRIKQDYSVEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILNYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|I1V161_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus B serotype 7 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILNYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|P03248_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus B serotype 7 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|Q5EY83_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus B serotype 7 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDIPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|Q6RK98_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus B serotype 7 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
© 1998-2018