Dataset for protein E1B 19K of organism Human adenovirus B serotype 35

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q7T951_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus B serotype 35 GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLESASDGVSGFWRFWFASELARVVFRIKQDYKQEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFIATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
© 1998-2018