Dataset for protein E1B 19K of organism Human adenovirus A serotype 31

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|D0Z5R9_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus A serotype 31 GN=E1B19K (length=156 residues).
MELEAVLQSFQSVRQLLQYTSKNTSGFWRYLFGSTLSKVVHRVKEDYREEFENILADCPGLLASLDLCHHSVFQERVVRS
LDFSSSGRTVASIAFLATVLDKWSERSHLSWDYMLDYMAMHLWRAWLKRRVCIYSLARPLTMPPLQEEQQNTTTEE
© 1998-2018