Dataset for protein E1B 19K of organism Human adenovirus 64

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|B6C6W8_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 64 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELN
© 1998-2018