Dataset for protein adenoviridae of organism Human adenovirus 55

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|C7SRS7_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 55 GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASEIARVVFRIKQDYKEEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFVATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|J7H4R9_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 55 GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFVATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
© 1998-2018