Dataset for protein E1B 19K of organism Human adenovirus 4p

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3G9CMQ4_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 4p GN=E1B19K (length=171 residues).
MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFIFDKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAISGYLPVQPLDTLRILSLQQQEDQEEN
PRAGLDPPAEE
© 1998-2019