Dataset for protein E1B 19K of organism Human adenovirus 4a

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3G9JTX5_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 4a GN=E1B19K (length=142 residues).
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAIPATCRYSR
© 1998-2019