Dataset for protein adenoviridae of organism Human adenovirus 46

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q4KSL0_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 46 GN=E1B19K (length=208 residues).
MTHGRGLVLYKWQHLGTGAQTFREFLMDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENL
FADCSGLLDSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRI
LNYWLLQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLDPPSEEELD
© 1998-2018