Dataset for protein adenoviridae of organism Human adenovirus 23

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|M0QUB4_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 23 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|W8CZB0_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 23 GN=E1B19K (length=182 residues).
MEVWTILGDFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
© 1998-2018