Dataset for protein E1B 19K of organism Human adenovirus 22

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|C5HDR2_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 22 GN=E1B19K (length=208 residues).
MTHGRGLVLYKWQHLGTWAQTFREFLMDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENL
FADCSGLLDSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRI
LNYWLIQPAVPGLLRLHRQTSMLEEEMRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|D3GBW3_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 22 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAVPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
© 1998-2018