Dataset for protein adenoviridae of organism Human adenovirus 21

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A0B4SJH1_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 21 GN=E1B19K (length=178 residues).
MEVWAILEDLKQTRLLLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPAMPAVLE
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|Q2KS85_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 21 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPAMPAVLE
EEQQEDNPRAGLDPPVEE
© 1998-2018