Dataset for protein adenoviridae of organism Human adenovirus 20

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|M0QU76_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 20 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEIENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
© 1998-2018