Dataset for protein Unclassified of organism Equine adenovirus B serotype 2

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0K1DBT8_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Equine adenovirus B serotype 2 (length=138 residues).
MDLMKLLDFKEFKRCVYLASNRCRWWEKIFCTRFIKFVRQIKKENFLEFAELILCNTAFSSCLKSGQVSLFHNTVLCELD
FSNPGRVVTNLAFLSYLIDMWDQVDVFSHEFILESVCFPAWQRFNQTQPKGVLKSTEV
© 1998-2018