Dataset for protein Unclassified of organism Equine adenovirus A serotype 1

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A1B0XB89_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Equine adenovirus A serotype 1 (length=261 residues).
MQQRTRKLRQRMRRPVTMTRRGAPGAWRNKRSPWTCLSDTPVKSENKKQICGHATGVVVLLISACLVWLLHLLFRQGLGE
VGMEVLNYCRNYYEFRRMIKGTTYSLGWVRRWLFSPLSDVVCMVAEKNELAYWRALPPSHFYWDMLKRGHAFFGKEDLFA
CVDLSTGGRVLASLGFLAFVLRHWPRDSVVPFEQRLDLICAPAWTRMQMWIQMEESRALEQQQPPEETIEEEEETSDAEE
TGSMEGLEDSDEEDLESLVVR
>gnl|bcl2dbpro|G5CZ72_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Equine adenovirus A serotype 1 (length=179 residues).
MEVLNYCRNYYEFRRMIKGTTYSLGWVRRWLFSPLSDVVCMVAEKNELAYWRALPPSHFYWDMLKRGHAFFGKEDLFACV
DLSTGGRVLASLGFLAFVLRHWPRDSVVPFEQRLDLICAPAWTRMQMWIQMEESRALEQQQPPEETIEEEEETSDAEETG
SMEGLEDSDEEDLESLVVR
© 1998-2018